PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01112.1.g00180.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family WRKY
Protein Properties Length: 413aa    MW: 44630.3 Da    PI: 7.1009
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01112.1.g00180.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY96.51.8e-30182238259
                                   --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                          WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                   +Dgy+WrKYGqK+ kg+e prsYY+Ct +gCpvkk vers  d+ ++eitY+g+Hnh+
  Zpz_sc01112.1.g00180.1.sm.mk 182 KDGYSWRKYGQKQLKGAESPRSYYKCTREGCPVKKVVERSF-DGFITEITYKGRHNHP 238
                                   8****************************************.***************8 PP

2WRKY103.31.4e-32313371159
                                   ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                          WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                   ldDgy+WrKYGqK+vkg++ prsYY+Ct  +C+v+k++er+++dp++v +tY g+Hnh+
  Zpz_sc01112.1.g00180.1.sm.mk 313 LDDGYRWRKYGQKVVKGNPRPRSYYKCTADNCNVRKQIERASTDPRCVLTTYAGRHNHD 371
                                   59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.3E-27178240IPR003657WRKY domain
SuperFamilySSF1182902.62E-24180240IPR003657WRKY domain
SMARTSM007746.9E-33181239IPR003657WRKY domain
PfamPF031065.6E-24182238IPR003657WRKY domain
PROSITE profilePS5081123.984183240IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.1E-33298373IPR003657WRKY domain
SuperFamilySSF1182907.59E-28306373IPR003657WRKY domain
PROSITE profilePS5081135.221308373IPR003657WRKY domain
SMARTSM007744.1E-35313372IPR003657WRKY domain
PfamPF031063.5E-24314371IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
MDDRRGRGGD AMRHRPFASA QERVFDGGGA GPSFGGDFDQ GSSYMELLSA GVNPQPPPPL  60
PQWAVEEMAA APAINLVPQS FSTANFTSSS SSYQHPASFA AVSPLSYSTQ PYAPLYLQQT  120
DLPPTQWHPR PAIMSAASSY LPPNFSFLPA AAHNNQLQQH VVHLRGGAGG QPSPAVIEQP  180
AKDGYSWRKY GQKQLKGAES PRSYYKCTRE GCPVKKVVER SFDGFITEIT YKGRHNHPRP  240
PQRGNDGDVP AGIIAEEALD GQSDHDDDED VLHEDHDGDE GHRAMGADGT VAGQRVVKKP  300
KIILQTPSDV DLLDDGYRWR KYGQKVVKGN PRPRSYYKCT ADNCNVRKQI ERASTDPRCV  360
LTTYAGRHNH DPPGQGPDAA AAPGGASAHH PAAAGGSGMF QQTGGSRQLK EES
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A6e-33183373877Probable WRKY transcription factor 4
1wj2_A6e-33183373877Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3638032e-82AK363803.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2019A07.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014661260.11e-144PREDICTED: probable WRKY transcription factor 26
TrEMBLA0A096PUU61e-142A0A096PUU6_MAIZE; Uncharacterized protein
TrEMBLK4A5N41e-139K4A5N4_SETIT; Uncharacterized protein
STRINGSi034188m1e-139(Setaria italica)
STRINGGRMZM2G008029_P011e-142(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28753236
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.16e-68WRKY DNA-binding protein 3